Isgf3g (BC005435) Mouse Recombinant Protein
CAT#: TP506259
Purified recombinant protein of Mouse interferon dependent positive acting transcription factor 3 gamma (cDNA clone MGC:5974 IMAGE:3601255), complete, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206259 representing BC005435
Red=Cloning site Green=Tags(s) MASGKVRCTRKLRSWIVEQVESGHFPGVCWDDAAKTMFRIPWKHAGKQDFREDQDAAIFKAWALFKEKHK DGDIGHPAVWKTRLRCALNKSSEFEEVPERGRMDVAEPYKVYRILPAGTLPNQPRNQKSPCKRSISCVSP EREENMENGRTNGVVNHSDSGSNIGGGGNGSNRSDSNSNCNSELEEGAGTTEATIREDPVFLEHQLPLNS DYSLLLTFIYGGRVVGKTQVHSLDCRLVAERSDSESSMEQVEFPKPDPLEPTQHLLNQLDRGVLVASNSR GLFVQRLCPIPISWNAPEAPPGPGPHLLPSNKCVELFKTTYFCRDLAQYFQGQGPPPKFQATLHFWEESP GSSHSQENLITVQMEQAFARHLLEKIPEEEKAALFLLQHTEQSPSALGH myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 85.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 16391 |
UniProt ID | Q61179 |
Refseq Size | 2341 |
Cytogenetics | 14 28.19 cM |
Refseq ORF | 1197 |
Synonyms | p48, Irf-9 |
Summary | Transcription factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G associates with the phosphorylated STAT1:STAT2 dimer to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |