Sec14l2 (NM_144520) Mouse Recombinant Protein
CAT#: TP506338
Purified recombinant protein of Mouse SEC14-like lipid binding 2 (Sec14l2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR206338 protein sequence
Red=Cloning site Green=Tags(s) MSGRVGDLSPKQEEALAKFRENVQDVLPTLPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDK IISWQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRDCELLLQECIQQTT KLGKKIETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLS EDTRRKIMVLGANWKEVLLKHISPDQLPVEYGGTMTDPDGNPKCKSKINYGGDIPKQYYVRDQVKQQYEH TVQVSRGSSHQVEYEILFPGCVLRWQFMSEGSDVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHMVPED GTLTCSEPGIYVLRFDNTYSFIHAKKVSFTVEVLLPDKAAEEKMNQQGADTPK myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 46.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_653103 |
| Locus ID | 67815 |
| UniProt ID | Q99J08 |
| Refseq Size | 2529 |
| Cytogenetics | 11 A1 |
| Refseq ORF | 1209 |
| Synonyms | 1300013M05Rik; Spf; TAP |
| Summary | Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Sec14l2产品
