Tank (NM_001164072) Mouse Recombinant Protein

CAT#: TP506499

Purified recombinant protein of Mouse TRAF family member-associated Nf-kappa B activator (Tank), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206499 protein sequence
Red=Cloning site Green=Tags(s)

MDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKTENYEQRIREQQEQLSFQQNLIDRLKSQLLLVDSSRD
NSYGYVPLLEDSDRRKNNLTLDEPHDKVKLGTLRYKQSKVRRQEVSSGKESAKGLNIPLHHERDNIEKTF
WDLKEEFHRICLLAKAQKDHLSKLNIPDIATDTQCSVPIQCTDKTEKQEALFKPQAKDDINRGMSCVTAV
TPRGLGRDEEDTSFESLSKFNVKFPPMDNDSIFLHSTPEAPSILAPATPETVCQDRFNMEVRDNPGNFVK
TEETLFEIQGIDPITSAIQNLKTTDKTNPSNLRAPCLPAGDHNVFYVNTFPLQDPPDAPFPSLDSPGKAV
RGPQQPFWKPFLNQDTDLVVPSDSDSELLKPLVCEFCQELFPPSITSRGDFLRHLNTHFNGET

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001157544
Locus ID 21353
UniProt ID P70347
Refseq Size 2019
Cytogenetics 2 C1.3
Refseq ORF 1239
Synonyms C86182; E430026L09Rik; I-TRAF
Summary Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. Negatively regulates NF-kappaB signaling and cell survival upon DNA damage. Plays a role as an adapter to assemble ZC3H12A, USP10 in a deubiquitination complex which plays a negative feedback response to attenuate NF-kappaB activation through the deubiquitination of IKBKG or TRAF6 in response to interleukin-1-beta (IL1B) stimulation or upon DNA damage. Promotes UBP10-induced deubiquitination of TRAF6 in response to DNA damage. May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2. Essential for the efficient induction of IRF-dependent transcription following infection with Sendai virus.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...