B4gat1 (NM_175383) Mouse Recombinant Protein

CAT#: TP506563

Purified recombinant protein of Mouse beta-1,4-glucuronyltransferase 1 (B4gat1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
Rabbit Polyclonal Anti-B3gnt1 Antibody
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206563 protein sequence
Red=Cloning site Green=Tags(s)

MQMSYAIRCAFYQLLLAALMLVAMLQLLYLSLLSGLHGQEEQEQYFEFFPPSPRSVDQVKSQLRTALASG
GVLDASGDYRVYRGLLKTTMDPNDVILATHASVDNLLHLSGLLERWEGPLSVSVFAATKEEAQLATVLAY
ALSSHCPEMRARVAMHLVCPSRYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNN
LLRNLAREEANYALVIDVDMVPSEGLWRGLREMLDQSNHWDGTALVVPAFEIRRSRRMPMNKNELVQLYQ
VGEVRPFYYGLCTPCHAPTNYSRWVNLPEESLLRPAYVVPWRDPWEPFYVAGGKVPTFDERFRQYGFNRI
SQACELHVAGFNFEVLNEGFLVHKGFKEALKFHPQKEAENQRNKILYRQFKQELKARYPNSPHRC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_780592
Locus ID 108902
UniProt ID Q8BWP8
Refseq Size 2035
Cytogenetics 19 A
Refseq ORF 1245
Synonyms 1500032M01Rik; B3gnt1; B3gnt6; BETA3GNT1; iGAT; iGNT
Summary Beta-1,4-glucuronyltransferase involved in O-mannosylation of alpha-dystroglycan (DAG1). Transfers a glucuronic acid (GlcA) residue onto a xylose (Xyl) acceptor to produce the glucuronyl-beta-1,4-xylose-beta disaccharide primer, which is further elongated by LARGE1, during synthesis of phosphorylated O-mannosyl glycan. Phosphorylated O-mannosyl glycan is a carbohydrate is a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity (PubMed:25279699). Required for axon guidance; via its function in O-mannosylation of alpha-dystroglycan (DAG1) (PubMed:23217742).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...