Acp2 (NM_007387) Mouse Recombinant Protein

CAT#: TP506733

Purified recombinant protein of Mouse acid phosphatase 2, lysosomal (Acp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206733 protein sequence
Red=Cloning site Green=Tags(s)

MAGRQTGWSQAALLQFLLGMCLTVMPPIQARSLRFVTLLYRHGDRSPVKTYPKDPYQEEKWPQGFGQLTK
EGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNEVQHFNPNISWQPIP
VHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNRSIQNAQFLNMVANETGLTNVTLETIWNVYDTL
FCEQTHGLLLPPWASPQTVQRLSQLKDFSFLFLFGIHEQVQKARLQGGVLLAQILKNLTLMATTSQFPKL
LVYSAHDTTLVALQMALNVYNGKQAPYASCHIFELYQEDNGNFSVEMYFRNDSKKAPWPLILPGCPHRCP
LQDFLRLTEPVIPKDWQKECQLANDTADTEVIVALAVCGSILFLLIVLLLTILFRMQAQPPGYHHVADRE
DHA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_031413
Locus ID 11432
UniProt ID P24638
Refseq Size 4669
Cytogenetics 2 50.54 cM
Refseq ORF 1269
Synonyms Acp; Acp-2; LAP
Summary The protein encoded by this gene belongs to the histidine acid phosphatase family, which hydrolyze orthophosphoric monoesters to alcohol and phosphate. This protein is localized to the lysosomal membrane, and is chemically and genetically distinct from the red cell acid phosphatase. Mice lacking this gene showed multiple defects, including bone structure alterations, lysosomal storage defects, and an increased tendency towards seizures. An enzymatically-inactive allele of this gene showed severe growth retardation, hair-follicle abnormalities, and an ataxia-like phenotype. Two isoforms are predicted to be produced from the same mRNA by the use of alternative in-frame translation termination codons via a stop codon readthrough mechanism. [provided by RefSeq, Oct 2017]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...