Skp2 (NM_013787) Mouse Recombinant Protein

CAT#: TP506755

Purified recombinant protein of Mouse S-phase kinase-associated protein 2 (p45) (Skp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206755 representing NM_013787
Red=Cloning site Green=Tags(s)

MHRKHLQEIPDQSGNVTTSFTWGWDSSKTSELLSGMGVSALEKEEVDSENIPHGLLSNLGHPQSPPRKRV
KGKGSDKDFVIIRRPKLSRENFPGVSWDSLPDELLLGIFSCLCLPELLRVSGVCKRWYRLSLDESLWQSL
DLAGKNLHPDVTVRLLSRGVVAFRCPRSFMEQPLGESFSSFRVQHMDLSNSVINVSNLHKILSECSKLQN
LSLEGLQLSDPIVKTLAQNENLVRLNLCGCSGFSESAVATLLSSCSRLDELNLSWCFDFTEKHVQAAVAH
LPNTITQLNLSGYRKNLQKTDLCTIIKRCPNLIRLDLSDSIMLKNDCFPEFFQLNYLQHLSLSRCYDIIP
DTLLELGEIPTLKTLQVFGIVPEGTLQLLREALPRLQINCAYFTTIARPTMDSKKNLEIWGIKCRLTLQK
PSCL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_038815
Locus ID 27401
UniProt ID Q9Z0Z3
Refseq Size 3204
Cytogenetics 15 A1
Refseq ORF 1272
Synonyms 4930500A04Rik; FBXL1; FWD1; p45
Summary Substrate recognition component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. The SCF complex provides substrate specificity and interacts with both, the E2 ubiquitin-conjugating enzyme and the substrate. Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. Degradation of CDKN1B/p27kip also requires CKS1. Promotes ubiquitination and destruction of CDH1 in a CK1-Dependent Manner, thereby regulating cell migration (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...