Pacsin1 (NM_011861) Mouse Recombinant Protein
CAT#: TP507030
Purified recombinant protein of Mouse protein kinase C and casein kinase substrate in neurons 1 (Pacsin1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR207030 protein sequence
Red=Cloning site Green=Tags(s) MSGSYDEASEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEK GPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQ KPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVL EDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQED LRWFRSTSGPGMPMNWPQFEEWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAGDRGSVSSYDRG QTYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGW CRGRLDSGQLGLYPANYVEAI myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 50.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035991 |
Locus ID | 23969 |
UniProt ID | Q61644 |
Refseq Size | 4215 |
Cytogenetics | 17 A3.3 |
Refseq ORF | 1323 |
Synonyms | A830061D09Rik; H74; mKIAA1379; syndapin |
Summary | Binds to membranes via its F-BAR domain and mediates membrane tubulation. Plays a role in the reorganization of the microtubule cytoskeleton via its interaction with MAPT; this decreases microtubule stability and inhibits MAPT-induced microtubule polymerization. Plays a role in cellular transport processes by recruiting DNM1, DNM2 and DNM3 to membranes. Plays a role in the reorganization of the actin cytoskeleton and in neuron morphogenesis via its interaction with COBL and WASL, and by recruiting COBL to the cell cortex. Plays a role in the regulation of neurite formation, neurite branching and the regulation of neurite length. Required for normal synaptic vesicle endocytosis; this process retrieves previously released neurotransmitters to accommodate multiple cycles of neurotransmission. Required for normal excitatory and inhibitory synaptic transmission.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Pacsin1产品