Ubxn6 (NM_024432) Mouse Recombinant Protein

CAT#: TP507042

Purified recombinant protein of Mouse UBX domain protein 6 (Ubxn6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
Ubxn6 Antibody - middle region
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207042 protein sequence
Red=Cloning site Green=Tags(s)

MKKFFQEIKADIKFKSAGPGQKLTDSAGEKTTKGKSPQLALRQPRQGPTDEAQMAAAAALARLEQKQPRA
RGPTSQDSIRNQVRKELQAEATSSNNPGAPGTNSVPEPKEEISPHLAVPGVFFICPLTGVTLRRDQRDAH
IKQAILSHFSTDPVAASIMKIHTFNRDRDRVKLGVDTIAKYLDNIHLHPEEEKYQKIKLQNKVFQERINC
LEGSHEFFEAIGFKKVTLPVPDQEGQEEFYVLGEDARAQPQNLARHKQQLLDAEPVRATLDRQLRVFRPS
ALASHFELPSDFFSLTAEEVKREQRLRTEAVERLSSLRTKAMREKEEQRELRKYTYALVRVRLPDGCLLQ
GTFYAREKLSALFRFVREALQNDWLPFELRASGGQKLEENEALALNECGLVPSALLTFSWDASVLEDIRA
AGAEPAKSVLRPELLAAIEQLS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 49.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_077752
Locus ID 66530
UniProt ID Q99PL6
Refseq Size 1714
Cytogenetics 17 D
Refseq ORF 1326
Synonyms 1200008L11Rik; 2210415J11Rik; AU040909; Ubxd1; Ubxdc2
Summary May negatively regulate the ATPase activity of VCP, an ATP-driven segregase that associates with different cofactors to control a wide variety of cellular processes. As a cofactor of VCP, it may play a role in the transport of CAV1 to lysosomes for degradation. It may also play a role in endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins. Together with VCP and other cofactors, it may play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...