F7 (NM_010172) Mouse Recombinant Protein
CAT#: TP507115
Purified recombinant protein of Mouse coagulation factor VII (F7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
Product images
                    
                CNY 600.00
Specifications
| Product Data | |
| Species | Mouse | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >MR207115 protein sequence 
Red=Cloning site Green=Tags(s) MVPQAHGLLLLCFLLQLQGPLGTAVFITQEEAHGVLHRQRRANSLLEELWPGSLERECNEEQCSFEEARE IFKSPERTKQFWIVYSDGDQCASNPCQNGGTCQDHLKSYVCFCLLDFEGRNCEKSKNEQLICANENGDCD QYCRDHVGTKRTCSCHEDYTLQPDEVSCKPKVEYPCGRIPVVEKRNSSSRQGRIVGGNVCPKGECPWQAV LKINGLLLCGAVLLDARWIVTAAHCFDNIRYWGNITVVMGEHDFSEKDGDEQVRRVTQVIMPDKYIRGKI NHDIALLRLHRPVTFTDYVVPLCLPEKSFSENTLARIRFSRVSGWGQLLDRGATALELMSIEVPRLMTQD CLEHAKHSSNTPKITENMFCAGYMDGTKDACKGDSGGPHATHYHGTWYLTGVVSWGEGCAAIGHIGVYTR VSQYIDWLVRHMDSKLQVGVFRLPLL myc-FLAG tag  | 
        
| Tag | C-MYC/DDK | 
| Predicted MW | 50.3 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C after receiving vials. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_034302 | 
| Locus ID | 14068 | 
| UniProt ID | P70375 | 
| Refseq Size | 1868 | 
| Cytogenetics | 8 5.73 cM | 
| Refseq ORF | 1338 | 
| Synonyms | AI132620; Cf7; F; FVII | 
| Summary | This gene encodes a vitamin K-dependent serine protease that plays a critical role in the extrinsic pathway of blood coagulation. Upon contact with tissue factor III (TF III), the encoded protein forms an activated complex termed TF-FVIIa that initiates the coagulation cascade involving other coagulation factors, ultimately resulting in a fibrin clot. Complete lack of the encoded protein in mice results in in perinatal lethality due to bleeding from normal blood vessels. [provided by RefSeq, Apr 2015] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402739 | F7 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 1470.00  | 
                                            |
| LY402739 | Transient overexpression lysate of coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2 | 
                                                     CNY 4840.00  | 
                                            |
| PH313143 | F7 MS Standard C13 and N15-labeled recombinant protein (NP_062562) | 
                                                     CNY 19520.00  | 
                                            |
| TP313143 | Recombinant protein of human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP701041 | Purified recombinant protein of Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug | 
                                                     CNY 7106.00  | 
                                            
