Tnip2 (BC052083) Mouse Recombinant Protein

CAT#: TP507193

Purified recombinant protein of Mouse TNFAIP3 interacting protein 2 (cDNA clone MGC:62501 IMAGE:6404610), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207193 protein sequence
Red=Cloning site Green=Tags(s)

MSSGDPRSGRQDGAPRAAAALCGLYHEAGQQLQRLKDQLAARDALIASLRTRLAALEGHTAPSLVDALLD
QVERFREQLRRQEEGASETQLRQEVERLTERLEEKEREMQQLMSQPQHEQEKEVVLLRRSVAEKEKARAA
SDVLCRSLADETHQLRRTLAATAHMCQHLAKCLDERQCAQGDAGEKSPAEEVRWICGQAYTKDLKKPPGC
WLEQTSSDASGQSVIKKLQEENRLLKQKVTHVEDLNAKWQRYDASRDEYVKGLHAQLKRRQVPLEPELMK
KEISRLNRQLEEKISDCAEANQELTAMRMSRDTALERVQMLEQQILAYKDDFKSERADRERAHSRIQELE
EKIMSLMYQVSQRQDSREPGPCRIHTGNKTAKYLEMDALEHVTPGGWRPESRSQQMEPSAEGGHVCTAQR
GQGDLQCPHCLRCFSDEQGEAFLRHLSECCQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 51.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 231130
UniProt ID Q99JG7
Refseq Size 2039
Cytogenetics 5 B2
Refseq ORF 1353
Synonyms 1810020H16Rik; ABIN-2; AI428870
Summary Inhibits NF-kappa-B activation by blocking the interaction of RIPK1 with its downstream effector NEMO/IKBKG. Forms a ternary complex with NFKB1 and MAP3K8 but appears to function upstream of MAP3K8 in the TLR4 signaling pathway that regulates MAP3K8 activation. Involved in activation of the MEK/ERK signaling pathway during innate immune response; this function seems to be stimulus- and cell type specific. Required for stability of MAP3K8. Involved in regulation of apoptosis in endothelial cells; promotes TEK agonist-stimulated endothelial survival. May act as transcriptional coactivator when translocated to the nucleus. Enhances CHUK-mediated NF-kappa-B activation involving NF-kappa-B p50-p65 and p50-c-Rel complexes.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...