Atg4c (NM_001145967) Mouse Recombinant Protein

CAT#: TP507307

Purified recombinant protein of Mouse autophagy related 4C, cysteine peptidase (Atg4c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207307 protein sequence
Red=Cloning site Green=Tags(s)

MEASGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDESKMLPARSGCAIEDH
VIAGNVEEFRKDFISRLWLTYREEFPQIEASALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALH
IENADSDSWTSNTVKKFTASFEASLSGDRELRTPAVSLKETSGKCPDDHAVRNEAYHRKIISWFGDSPVA
VFGLHRLIEFGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGLTIYVAQDCTVYNSDVIDKQTDSVT
AGDARDKAVIILVPVRLGGERTNTDYLEFVKGVLSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQ
SFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFERASEEITKMLKISSKEKYPLFTFVN
GHSKDFDFTSTAASEEDLFSEDERKNFKRFSTEEFVLL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 52.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001139439
Locus ID 242557
UniProt ID Q811C2
Refseq Size 2854
Cytogenetics 4 C6
Refseq ORF 1374
Synonyms Apg4-C; Apg4c; Atg4cl; Autl1
Summary Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Cleaves the C-terminal amino acid of ATG8 family proteins MAP1LC3 and GABARAPL2, to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. Has also an activity of delipidating enzyme for the PE-conjugated forms (By similarity). Is not essential for autophagy development under normal conditions but is required for a proper autophagic response under stressful conditions such as prolonged starvation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...