Cdk5rap3 (NM_030248) Mouse Recombinant Protein
CAT#: TP508085
Purified recombinant protein of Mouse CDK5 regulatory subunit associated protein 3 (Cdk5rap3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR208085 protein sequence
Red=Cloning site Green=Tags(s) MQDHQHVPIDIQTSKLLDWLVDRRHCNLKWQSLVLTIREKINTAIQDMPESQEIAQLLSGSYIHYFHCLR IVDLLKGTEASTKNIFGRYSSQRMKDWQEIVSLYEKDNTYLVELCSLLVRNVSYEIPSLKKQIAKCQQLQ QEYSRKEEEGQAGAAEMREQFYHSCKQYGITGDNVRRELLALVKDLPSQLAEIGAGAQSLGEAIDLYQAC VEFVCDSPTEQVLPMLRYVQKKGNSTVYEWRTGTEPSVVERPQLEEPPEQVQEDEIDWGDFGVEAVSDSG IVAETPGIDWGISLESEAKDAGADKIDWGDDAAAASEITVLETGTEAPEGVARGSDALTLLEYPETRNQF IDELMELEIFLSQRAVEMSEEADILSVSQFQLAPAILQGQTKEKMLSLVSTLQQLIGRLTSLRMQHLFMI LASPRYVDRVTEFLQQKLKQSQLLALKKELMVEKQQEALQEQAALEPKLDLLLEKTRELQKLIEADISKR YSGRPVNLMGTSL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 57 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_084524 |
| Locus ID | 80280 |
| UniProt ID | Q99LM2 |
| Refseq Size | 1892 |
| Cytogenetics | 11 D |
| Refseq ORF | 1509 |
| Synonyms | 1810007E24Rik; BC002318; C53; C81486; HSF-27; IC53; LZAP; MST016 |
| Summary | Probable tumor suppressor initially identified as a CDK5R1 interactor controlling cell proliferation. Negatively regulates NF-kappa-B-mediated gene transcription through the control of RELA phosphorylation. Also regulates mitotic G2/M transition checkpoint and mitotic G2 DNA damage checkpoint. Through its interaction with CDKN2A/ARF and MDM2 may induce MDM2-dependent p53/TP53 ubiquitination, stabilization and activation in the nucleus, thereby promoting G1 cell cycle arrest and inhibition of cell proliferation. May play a role in the unfolded protein response, mediating the ufmylation of multiple proteins in response to endoplasmic reticulum stress. May also play a role in the rupture of the nuclear envelope during apoptosis. May regulate MAPK14 activity by regulating its dephosphorylation by PPM1D/WIP1.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Cdk5rap3产品
