Atp6v1b1 (NM_134157) Mouse Recombinant Protein
CAT#: TP508239
Purified recombinant protein of Mouse ATPase, H+ transporting, lysosomal V1 subunit B1 (Atp6v1b1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
Product images
                    
                CNY 600.00
Specifications
| Product Data | |
| Species | Mouse | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >MR208239 protein sequence 
Red=Cloning site Green=Tags(s) MATTVDSRSSGFTGNSCDPGTAQEHVQAVTRNYITHPRVTYRTVCSVNGPLVVLDQVKFAQYAEIVNFTL PDGTQRSGQVLEVAGTKAIVQVFEGTSGIDSQKTTCEFTGDILRTPVSEDMLGRIFNGSGKPIDKGPAVM AEEFLDINGQPINPHDRIYPEEMIQTGISPIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKS KAVLDYHEDNFAIVFAAMGVNMETARFFKSDFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLA YQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTM PNDDITHPIPDLTGFITEGQIYVDRQLHNRQVYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACY AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFITQGPYENRTVFESLDLGWKLLRIFPKEMLKRIP QSMTDEFYSRQGAQQDPASDTAL myc-FLAG tag  | 
        
| Tag | C-MYC/DDK | 
| Predicted MW | 57.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C after receiving vials. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_598918 | 
| Locus ID | 110935 | 
| UniProt ID | Q91YH6 | 
| Refseq Size | 1945 | 
| Cytogenetics | 6 35.94 cM | 
| Refseq ORF | 1539 | 
| Synonyms | Atp6b1; AW208839; D630003L15; D630030L16Rik; D630039P21Rik; Vpp-3; Vpp3 | 
| Summary | Non-catalytic subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed:16174750, PubMed:23028982). V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment (By similarity). Essential for the proper assembly and activity of V-ATPase (By similarity). In renal intercalated cells, mediates secretion of protons (H+) into the urine thereby ensuring correct urinary acidification (PubMed:16174750). Required for optimal olfactory function by mediating the acidification of the nasal olfactory epithelium (PubMed:23028982).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
其它Atp6v1b1产品
