Mettl16 (NM_026197) Mouse Recombinant Protein
CAT#: TP508777
Purified recombinant protein of Mouse methyltransferase like 16 (Mettl16), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR208777 protein sequence
Red=Cloning site Green=Tags(s) MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHIQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDI PLERLIPTVPLRLNYIHWVEDLIGHQDSDKTTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFN YAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIVYDFCMCNPPFFANQLEAKGVNSRNSRRPPPSSV NTGGITEIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIQGVPKVTFTEFCQGRT MRWALAWSFYDDVTVPSPPSKRRKLEKPRKPITFVVLESVMKELSLKASSLGSETAEGIVVVTTWIEKIL TDLKVQHKRIPCGREEVSLFLTAIENSWIHLRRKRRERVRQLREVPRAPEDVILALEERKSTPKELSSGQ DVAHSPQESALCGLDVPGGEAAADGGHCLSQKLLCQEETPEATEDERDEERGGMEAMESCKGSSNGAQDG EASEKGDRLDGAAGRYLFKCLVNIKKEAGDAVVEMHWVEGQNRDLMNQLCTYVRNQILRLVAS myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 62.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_080473 |
| Locus ID | 67493 |
| UniProt ID | Q9CQG2 |
| Refseq Size | 2718 |
| Cytogenetics | 11 B5 |
| Refseq ORF | 1659 |
| Synonyms | 2610100D03Rik; 2810013M15Rik; A830095F14Rik; AI846133; Mett10d |
| Summary | RNA N6-methyltransferase that methylates adenosine residues at the N(6) position of a subset of RNAs and is involved in S-adenosyl-L-methionine homeostasis by regulating expression of MAT2A transcripts (PubMed:29262316, PubMed:30197299). Able to N6-methylate a subset of mRNAs and U6 small nuclear RNAs (U6 snRNAs) (By similarity). In contrast to the METTL3-METTL14 heterodimer, only able to methylate a limited number of RNAs: requires both a 5'UACAGAGAA-3' nonamer sequence and a specific RNA structure (By similarity). Plays a key role in S-adenosyl-L-methionine homeostasis by mediating N6-methylation of MAT2A mRNAs, altering splicing and/or stability of MAT2A transcripts: in presence of S-adenosyl-L-methionine, binds the 3' UTR region of MAT2A mRNA and specifically N6-methylates the first hairpin of MAT2A mRNA, impairing MAT2A expression (PubMed:29262316, PubMed:30197299). In S-adenosyl-L-methionine-limiting conditions, binds the 3' UTR region of MAT2A mRNA but stalls due to the lack of a methyl donor, preventing N6-methylation and promoting expression of MAT2A (PubMed:29262316). In addition to mRNAs, also able to mediate N6-methylation of U6 small nuclear RNA (U6 snRNA): specifically N6-methylates adenine in position 43 of U6 snRNAs (By similarity). Also able to bind various lncRNAs (By similarity). Specifically binds the 3'-end of the MALAT1 long non-coding RNA (By similarity) (PubMed:29262316, PubMed:30197299).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Mettl16产品
