Ly9 (NM_008534) Mouse Recombinant Protein

CAT#: TP509585

Purified recombinant protein of Mouse lymphocyte antigen 9 (Ly9), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209585 representing NM_008534
Red=Cloning site Green=Tags(s)

MADLKRYWCDWALGPLSENPRMSQQQIFSPILWIPLLFLLMGLGASGKETPPTVISGMLGGSVTFSLNIS
KDAEIEHIIWNCPPKALALVFYKKDITILDKGYNGRLKVSEDGYSLYMSNLTKSDSGSYHAQINQKNVIL
TTNKEFTLHIYEKLQKPQIIVESVTPSDTDSCTFTLICTVKGTKDSVQYSWTREDTHLNTYDGSHTLRVS
QSVCDPDLPYTCKAWNPVSQNSSQPVRIWQFCTGASRRKTAAGKTVVGILGEPVTLPLEFRATRATKNVV
WVFNTSVISQERRGAATADSRRKPKGSEERRVRTSDQDQSLKISQLKMEDAGPYHAYVCSEASRDPSVRH
FTLLVYKRLEKPSVTKSPVHMMNGICEVVLTCSVDGGGNNVTYTWMPLQNKAVMSQGKSHLNVSWESGEH
LPNFTCTAHNPVSNSSSQFSSGTICSGPERNKRFWLLLLLVLLLLMLIGGYFILRKKKQCSSLATRYRQA
EVPAEIPETPTGHGQFSVLSQRYEKLDMSAKTTRHQPTPTSDTSSESSATTEEDDEKTRMHSTANSRNQV
YDLVTHQDIAHALAYEGQVEYEAITPYDKVDGSMDEEDMAYIQVSLNVQGETPLPQKKEDSNTIYCSVQK
PKKTAQTPQQDAESPETPTYENFT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 73.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_032560
Locus ID 17085
UniProt ID Q01965
Refseq Size 2449
Cytogenetics 1 79.54 cM
Refseq ORF 1962
Synonyms AI893573; CD229; Lgp100; Ly-9; SLAMF3; T100
Summary Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2 (PubMed:19648922). May participate in adhesion reactions between T lymphocytes and accessory cells by homophilic interaction. Promotes T-cell differentiation into a helper T-cell Th17 phenotype leading to increased IL-17 secretion; the costimulatory activity requires SH2D1A. Promotes recruitment of RORC to the IL-17 promoter (By similarity). May be involved in the maintenance of peripheral cell tolerance by serving as a negative regulator of the immune response. May disable autoantibody responses and inhibit IFN-gamma secretion by CD4(+) T-cells (PubMed:23914190). May negatively regulate the size of thymic innate CD8(+) T-cells and the development of invariant natural killer T (iNKT) cells (PubMed:23225888). Can promote natural killer (NK) cell activation (PubMed:19648922).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...