Pot1a (NM_133931) Mouse Recombinant Protein

CAT#: TP509691

Purified recombinant protein of Mouse protection of telomeres 1A (Pot1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209691 representing NM_133931
Red=Cloning site Green=Tags(s)

MSLVSTAPYTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQTNVKLTCMLFSGNYEALP
IIYKVGDIVRFHRLKIQVYKNELQGINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQKMVEALRVWA
SKHISASSTLVQLCDAQPMQYYDLTCQLLGKAQVDSTAFLLKVWDGTQTVLPSWRVSTQDLTFEGDLSHI
ERLQSLVVDILVYDNHVQVARSIEVGCFLRLYSLHTKLQPGNSETSSSESLRLEFHLHGGTSYGRGIRVL
PDTSPCVDQLKKALEGANLPVTETSTGICQSENGDSSALSNSGSGAVSPYEEERCQQVSATILTNHQHLE
KTPLCAILTQKAPQQYRVRAKLRSYLPRRLSQSVKLLCPKCHSVQEVPHGDSLDKILQDAATEAPDIKLK
ATSLYYSKVWTTEDQGGRQVAVHFVKNNGILPASSECLILIEGGRLCEVSKLSSKFHSVMPVRSGPESLE
LLTLSAPFLIQGKVHHYGCKQCSSLKPIQNLNSRFHKGPWTPSSVAEALGVVPLQYVFVMVFTLDDGTGV
LEAYLKDSEHFFKIPASEVLTDDDLQRSLETIMDMICPPGIKVDAYPWLECLLKSYNVTIGTERRICYQI
FDTTVAENVV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 71.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598692
Locus ID 101185
UniProt ID Q91WC1
Refseq Size 3153
Cytogenetics 6 A3.1
Refseq ORF 1920
Synonyms 1500031H18Rik; AI851169; Pot1
Summary Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. Is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere length by cis-inhibition of telomerase. Also acts as a single-stranded telomeric DNA-binding protein and thus may act as a downstream effector of the TRF1 complex and may transduce information about telomere maintenance and/or length to the telomere terminus. Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats (G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. Binds telomeric single-stranded sequences internally or at proximity of a 3'-end. Its activity is TERT dependent but it does not increase TERT activity (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...