Limd1 (NM_013860) Mouse Recombinant Protein

CAT#: TP509904

Purified recombinant protein of Mouse LIM domains containing 1 (Limd1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209904 protein sequence
Red=Cloning site Green=Tags(s)

MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQQQQQLLQEEA
LPRAGRSPVNGGNRQGASGKLAADGAAKPPLAVPTVAPGLATTTAAAQPSYPSQEQRIRPSAHGARPGSQ
NCGSREGPVSSQRPALHGLSPSCEDPSCLTHGDYYDNFSLASPQWGDKPEGCPSVSLGVGSGWPGCPGND
STLPKSCGDHHPYQPQLSTVCSGRSFESGISGQDGGIGGHSSEKPTGLWSTASSQRVNLGFSSMGLENGT
SAQPKGTTVSAPMVPSSASQGACPKRDSGLGYEASGRVFKPLVDTQPWLQDGPKSYLSVSAPLSSTAGKD
STQPGMTTGLDPKFGCVESGTSPKPSPTSNVHPVMSTPSELSCKESSPSWSTDSSLEPVLPGSPTPSRVR
LPCQTLAPGPELGPSTAELKLEALTQRLEREMDAHPKADYFGSCVKCSKGVFGAGQACQAMGDLYHDACF
TCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMILQALGKSYHPGCFRCVICNE
CLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELN
DEDGHRCYPLEDHLFCHSCHVKRLEKGPSPAPLHQHHF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 71.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_038888
Locus ID 29806
UniProt ID Q9QXD8
Refseq Size 4864
Cytogenetics 9 74.0 cM
Refseq ORF 2004
Synonyms AW822033; D9Ertd192e
Summary Adapter or scaffold protein which participates in the assembly of numerous protein complexes and is involved in several cellular processes such as cell fate determination, cytoskeletal organization, repression of gene transcription, cell-cell adhesion, cell differentiation, proliferation and migration. Positively regulates microRNA (miRNA)-mediated gene silencing and is essential for P-body formation and integrity. Acts as a hypoxic regulator by bridging an association between the prolyl hydroxylases and VHL enabling efficient degradation of HIF1A. Acts as a transcriptional corepressor for SNAI1- and SNAI2/SLUG-dependent repression of E-cadherin transcription. Negatively regulates the Hippo signaling pathway and antagonizes phosphorylation of YAP1. Inhibits E2F-mediated transcription, and suppresses the expression of the majority of genes with E2F1-responsive elements. Regulates osteoblast development, function, differentiation and stress osteoclastogenesis. Enhances the ability of TRAF6 to activate adapter protein complex 1 (AP-1) and negatively regulates the canonical Wnt receptor signaling pathway in osteoblasts. May act as a tumor suppressor by inhibiting cell proliferation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...