Ltf (NM_008522) Mouse Recombinant Protein
CAT#: TP510170
Purified recombinant protein of Mouse lactotransferrin (Ltf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
现货
规格
Product images
推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR210170 protein sequence
Red=Cloning site Green=Tags(s) MRLLIPSLIFLEALGLCLAKATTVRWCAVSNSEEEKCLRWQNEMRKVGGPPLSCVKKSSTRQCIQAIVTN RADAMTLDGGTMFDAGKPPYKLRPVAAEVYGTKEQPRTHYYAVAVVKNSSNFHLNQLQGLRSCHTGIGRS AGWKIPIGTLRPYLNWNGPPASLEEAVSKFFSKSCVPGAQKDRFPNLCSSCAGTGANKCASSPEEPYSGY AGALRCLRDNAGDVAFTRGSTVFEELPNKAERDQYKLLCPDNTWKPVTEYKECHLAQVPSHAVVSRSTND KEEAIWELLRQSQEKFGKKQASGFQLFASPSGQKDLLFKESAIGFVRVPQKVDVGLYLTFSYTTSIQNLN KKQQDVIASKARVTWCAVGSEEKRKCDQWNRASRGRVTCISFPTTEDCIVAIMKGDADAMSLDGGYIYTA GKCGLVPVLAENQKSSKSNGLDCVNRPVEGYLAVAAVRREDAGFTWSSLRGKKSCHTAVDRTAGWNIPMG LLANQTRSCKFNEFFSQSCAPGADPKSNLCALCIGDEKGENKCAPNSKERYQGYTGALRCLAEKAGNVAF LKDSTVLQNTDGKNTEEWARNLKLKDFELLCLDDTRKPVTEAKNCHLAIAPNHAVVSRTDKVEVLQQVLL DQQVQFGRNGQRCPGEFCLFQSKTKNLLFNDNTECLAKIPGKTTSEKYLGKEYVIATERLKQCSSSPLLE ACAFLTQ myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 77.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_032548 |
| Locus ID | 17002 |
| UniProt ID | P08071 |
| Refseq Size | 2742 |
| Cytogenetics | 9 60.79 cM |
| Refseq ORF | 2121 |
| Synonyms | Csp82; Lf; MMS10R; Ms10r |
| Summary | Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...

