Tafa3 (NM_183224) Mouse Recombinant Protein
CAT#: TP512524
Purified recombinant protein of Mouse TAFA chemokine like family member 3 (Tafa3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR212524 protein sequence
Red=Cloning site Green=Tags(s) MERPTSNWSAGSWVLALCLAWLWTCPASASLQPPTSAVLVKQGTCEVIAAHRCCNRNRIEERSQTVKCSC LSGQVAGTTRAKPSCVDASIVLQKWWCQMEPCLLGEECKVLPDLSGWSCSSGHKVKTTKVTR myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 14.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_899047 |
| Locus ID | 329731 |
| UniProt ID | Q7TPG6 |
| Refseq Size | 4317 |
| Cytogenetics | 3 F2.2 |
| Refseq ORF | 396 |
| Synonyms | 7530404M11Rik; Fam19; Fam19a3; Sa; Sam3; Taf; Tafa; Tafa-3 |
| Summary | This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
