Mreg (NM_001005423) Mouse Recombinant Protein
CAT#: TP515346
Purified recombinant protein of Mouse melanoregulin (Mreg), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR215346 representing NM_001005423
Red=Cloning site Green=Tags(s) MGLRRWLRSACCCCPCRCLEEPARPEKEPLVSGNNPYSSFGATLERDDEKNLWSMPHDVSHTEADDDRIL YNLIVIRNQQTKDSEEWQRLNYDIYTLRQIRREVRNRWRRILEDLGFQREADSLLSVTKLSTMSDSKNTR KAREMLLKLAEETSIFPASWELSERYLLVVDRLIALDAAEDFFKIASQMYPKKPGVPCLVDGQRKLHCLP FPSP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 25.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001005423 |
Locus ID | 381269 |
UniProt ID | Q6NVG5 |
Refseq Size | 2493 |
Cytogenetics | 1 C3 |
Refseq ORF | 642 |
Synonyms | dsu; Gm974; Wdt2 |
Summary | Probably functions as cargo-recognition protein that couples cytoplasmic vesicles to the transport machinery (PubMed:22940130, PubMed:22275436, PubMed:30174147). Plays a role in hair pigmentation, a process that involves shedding of melanosome-containing vesicles from melanocytes, followed by phagocytosis of the melanosome-containing vesicles by keratinocytes (PubMed:15550542, PubMed:3410303, PubMed:22753477). Functions on melanosomes as receptor for RILP and the complex formed by RILP and DCTN1, and thereby contributes to retrograde melanosome transport from the cell periphery to the center (PubMed:22940130, PubMed:22275436). Overexpression causes accumulation of late endosomes and/or lysosomes at the microtubule organising center (MTOC) at the center of the cell (PubMed:19240024, PubMed:30174147). Probably binds cholesterol and requires the presence of cholesterol in membranes to function in microtubule-mediated retrograde organelle transport (PubMed:30174147). Binds phosphatidylinositol 3-phosphate, phosphatidylinositol 4-phosphate, phosphatidylinositol 5-phosphate and phosphatidylinositol 3,5-bisphosphate, but not phosphatidylinositol 3,4-bisphosphate or phosphatidylinositol 4,5-bisphosphate (PubMed:19240024). Required for normal phagosome clearing and normal activation of lysosomal enzymes in lysosomes from retinal pigment epithelium cells (PubMed:19240024). Required for normal degradation of the lipofuscin component N-retinylidene-N-retinylethanolamine (A2E) in the eye (PubMed:19240024). May function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells (Probable).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...