Khdrbs2 (NM_133235) Mouse Recombinant Protein

CAT#: TP515998

Purified recombinant protein of Mouse KH domain containing, RNA binding, signal transduction associated 2 (Khdrbs2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR215998 protein sequence
Red=Cloning site Green=Tags(s)

MGEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQ
YPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKTKEEELRKSGEAKYAHLSDELHVLIEVFAP
PGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEESGRGRGIRGRGIRITPTAPSRGRGGAV
PPPPPPGRGVLTPRGTTVTRGALPVPPIARGVPTPRARGTAAVPGYRAPPPPAHDAYEEYGYDDGYGGEY
DDQTYEAYDNSYVTPTQSVPEYYDYGHGVNEDAYDSYAPEEWATTRSSLKAPPPRSARGGYREHPYGRY

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 38.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_573498
Locus ID 170771
UniProt ID Q9WU01
Refseq Size 1363
Cytogenetics 1 B
Refseq ORF 1047
Synonyms 6330586C16Rik; mSLM-1; Slim1; SLM; Slm-1; Slm1; Tg(LRRK2*R1441G)135Cjli; TG-RP135
Summary The protein encoded by this gene is similar to the src associated in mitosis, 68 kDa protein, which is an RNA-binding protein and a substrate for Src-family tyrosine kinases during mitosis. This protein has a KH RNA-binding motif and proline-rich motifs which may be SH2 and SH3 domain binding sites. A similar rat protein is an RNA-binding protein which is tyrosine phosphorylated by Src during mitosis. These studies also suggest that the rat protein may function as an adaptor protein for Src by binding the SH2 and SH3 domains of various other proteins. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...