Polh (NM_030715) Mouse Recombinant Protein

CAT#: TP516957

Purified recombinant protein of Mouse polymerase (DNA directed), eta (RAD 30 related) (Polh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR216957 representing NM_030715
Red=Cloning site Green=Tags(s)

MAPGQNRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRNMWADDAKK
LCPDLLLAQVRESRGKANLTKYREASVEVMEIMSYFAVIERASIDEAYIDLTSAVQERLQKLQGQPISAD
LLPSTYIEGLPRGPTVEETVQKEAIRKQGLLQWLDSLQSDDPTSPDLRLTVGAMIVEEMRAAIESKTGFQ
CSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEVLGIEYMGDLTQF
TESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLALELEER
LTKDRNDNDRVATQLVVSIRFQGDRRLSSLRRCCALPRYDAHKMSQDAFAAIRNCNTSGIQTEWSPPLTM
LFLCATKFSAAAPPACTDITAFLSSDSSCQPKVPIASSETRTQGSGPAVPTSKEAATSLASFFQKAAKKQ
RMKETSFVPLNTATEKLSSKPSLVFQSSQTTGSQSFFKQKSLLLQHTQLSNSAAPDPPQASPAAQPSCLP
AECVDSGPDDGAVKPVSSKAVSTEMNVAGDSPNVLDSPAYNSQEVTQRATEDQVLCEKCDSLVPVWDMPE
HTDYHFALELQKSFLQPCTSKPQAIPAVSPQGKRNPKSPSASSSKRLRPHGMQTLESFFKPLTH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 76.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_109640
Locus ID 80905
UniProt ID Q9JJN0
Refseq Size 2580
Cytogenetics 17 C
Refseq ORF 2082
Synonyms RAD30A; XPV
Summary DNA polymerase specifically involved in the DNA repair by translesion synthesis (TLS) (PubMed:10871396). Due to low processivity on both damaged and normal DNA, cooperates with the heterotetrameric (REV3L, REV7, POLD2 and POLD3) POLZ complex for complete bypass of DNA lesions. Inserts one or 2 nucleotide(s) opposite the lesion, the primer is further extended by the tetrameric POLZ complex. In the case of 1,2-intrastrand d(GpG)-cisplatin cross-link, inserts dCTP opposite the 3' guanine (By similarity). Particularly important for the repair of UV-induced pyrimidine dimers (PubMed:10871396). Although inserts the correct base, may cause base transitions and transversions depending upon the context. May play a role in hypermutation at immunoglobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have any lyase activity, preventing the release of the 5'-deoxyribose phosphate (5'-dRP) residue. This covalent trapping of the enzyme by the 5'-dRP residue inhibits its DNA synthetic activity during base excision repair, thereby avoiding high incidence of mutagenesis. Targets POLI to replication foci (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...