Acer1 (NM_175731) Mouse Recombinant Protein
CAT#: TP517552
Purified recombinant protein of Mouse alkaline ceramidase 1 (Acer1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR217552 representing NM_175731
Red=Cloning site Green=Tags(s) MHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPYAQKRTRCFYG VSVLFMLIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPKFVKGNRFYFSCLVTITTIIS TFLTFVKPTVNAYALNSIAIHILYIVRTEYKKIRDDDLRHLIAVSVVLWAAALTSWISDRVLCSFWQRIH FYYLHSIWHVLISITFPYGIVTMALVDAKYEMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 32.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_783858 |
| Locus ID | 171168 |
| UniProt ID | Q8R4X1 |
| Refseq Size | 2429 |
| Cytogenetics | 17 D |
| Refseq ORF | 819 |
| Synonyms | 2310024P18Rik; AI662009; Alkcdase1; Asah3; Cer1 |
| Summary | Endoplasmic reticulum ceramidase that catalyzes the hydrolysis of ceramides into sphingosine and free fatty acids at alkaline pH (PubMed:12783875). Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation (PubMed:12783875). Exhibits a strong substrate specificity towards the natural stereoisomer of ceramides with D-erythro-sphingosine as a backbone and has a higher activity towards very long-chain unsaturated fatty acids like the C24:1-ceramide (PubMed:12783875). May also hydrolyze dihydroceramides to produce dihydrosphingosine (By similarity). ACER1 is a skin-specific ceramidase that regulates the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes and more generally plays an important role in skin homeostasis (PubMed:27126290, PubMed:29056331).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
