Chst10 (NM_145142) Mouse Recombinant Protein

CAT#: TP517755

Purified recombinant protein of Mouse carbohydrate sulfotransferase 10 (Chst10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR217755 representing NM_145142
Red=Cloning site Green=Tags(s)

MENVNPSGRIIEWPLSDNMHHQWLLLAACFWVIFMFMVASKFITLTFKDPDGYSAKQEFVFLTTMPEAEK
LRGEKHFPEVPKPTGKMLSDSRPDQPPVYLERLELIRNTCKEEALRNLSHTEVSKFVLDRIFVCDKHKIL
FCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSKIGIQKRLKTYFKFFIVRDPF
ERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRKNRTETRGIQFEDFVRYLGDPNRRWLDLQFGDHIIH
WVTYVELCAPCEIKYSVVGHHETLEADAPYILKEAGIDHLVSYPTIPPGITMYNRTKVEQYFLGISKRDI
RRLYARFEGDFKLFGYQKPDFLLN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 44.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_660124
Locus ID 98388
UniProt ID Q6PGK7
Refseq Size 3135
Cytogenetics 1 B
Refseq ORF 1122
Synonyms AI507003; AU041319; Hnk-1st; ST
Summary Catalyzes the transfer of sulfate to position 3 of terminal glucuronic acid of both protein- and lipid-linked oligosaccharides. Participates in biosynthesis of HNK-1 carbohydrate structure, a sulfated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult. May be indirectly involved in synapse plasticity of the hippocampus, via its role in HNK-1 biosynthesis.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...