Pla2g2f (NM_012045) Mouse Recombinant Protein
CAT#: TP518100
Purified recombinant protein of Mouse phospholipase A2, group IIF (Pla2g2f), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR218100 protein sequence
Red=Cloning site Green=Tags(s) MADGAQANPKGFRKKALVKHSTGRKSPSLRASPSKTSRSSLGMKKFFAIAVLAGSVVTTAHSSLLNLKSM VEAITHRNSILSFVGYGCYCGLGGRGHPMDEVDWCCHAHDCCYEKLFEQGCRPYVDHYDHRIENGTMIVC TELNETECDKQTCECDKSLTLCLKDHPYRNKYRGYFNVYCQGPTPNCSIYDPYPEEVTCGHGLPATPVST myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 23.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036175 |
Locus ID | 26971 |
UniProt ID | Q9QZT4 |
Refseq Size | 2437 |
Cytogenetics | 4 D3 |
Refseq ORF | 630 |
Synonyms | GIIFsPLA2; sPLA2-IIF |
Summary | May play a role in lipid mediator production in inflammatory conditions, by providing arachidonic acid to downstream cyclooxygenases and lipoxygenases. Phospholipase A2, which catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides (PubMed:10531313). Hydrolyzes phosphatidylethanolamine more efficiently than phosphatidylcholine, with only a modest preference for arachidonic acid versus linoelic acid at the sn-2 position. Comparable activity toward 1-palmitoyl-2-oleoyl-phosphatidylserine vesicles to that toward 1-palmitoyl-2-oleoyl-phosphatidylglycerol (PubMed:11877435). Prefers phosphatidylglycerol compared to phosphatidylcholine (PubMed:10531313).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Pla2g2f产品