S100a13 (NM_009113) Mouse Recombinant Protein
CAT#: TP518324
Purified recombinant protein of Mouse S100 calcium binding protein A13 (S100a13), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR218324 representing NM_009113
Red=Cloning site Green=Tags(s) MASDSRGGPLSGGGNLTLQTWEWLSPCLVLINFSLRAPDRLAASHLLSRSICVDISSCFGILMAAETLTE LEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWR LIGELAKEVRKEKALGIRKK myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 18.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_033139 |
| Locus ID | 20196 |
| UniProt ID | P97352 |
| Refseq Size | 732 |
| Cytogenetics | 3 39.24 cM |
| Refseq ORF | 480 |
| Summary | Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它S100a13产品
