Tnfaip8l3 (NM_001033535) Mouse Recombinant Protein
CAT#: TP520028
Purified recombinant protein of Mouse tumor necrosis factor, alpha-induced protein 8-like 3 (Tnfaip8l3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR220028 representing NM_001033535
Red=Cloning site Green=Tags(s) MDSDSGEQSEGEPGTAAGPHVFSSKNLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTEIHTHN KKEAHKIMKDAIKVAIKIGILYRNKQFSQEEVIIVEKLRKKLNQTAMTMVSFYEVEYTFDTNVLSKLLHE CKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYGPHGNCRPNLKRICEGINKLLDDKIL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 23.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028707 |
Locus ID | 244882 |
UniProt ID | Q3TBL6 |
Refseq Size | 2225 |
Cytogenetics | 9 A5.3 |
Refseq ORF | 612 |
Synonyms | 9930029P06Rik; Gm517 |
Summary | Acts as a lipid transfer protein. Preferentially captures and shuttles two lipid second messengers, i.e., phosphatidylinositol 4,5- bisphosphate and phosphatidylinositol 3,4,5-trisphosphate and increases their levels in the plasma membrane. Additionally, may also function as a lipid-presenting protein to enhance the activity of the PI3K-AKT and MEK-ERK pathways. May act as a regulator of tumorigenesis through its activation of phospholipid signaling.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Tnfaip8l3产品