Tnfaip8l3 (NM_001033535) Mouse Recombinant Protein

CAT#: TP520028

Purified recombinant protein of Mouse tumor necrosis factor, alpha-induced protein 8-like 3 (Tnfaip8l3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
TNFAIP8L3 Antibody - middle region
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR220028 representing NM_001033535
Red=Cloning site Green=Tags(s)

MDSDSGEQSEGEPGTAAGPHVFSSKNLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTEIHTHN
KKEAHKIMKDAIKVAIKIGILYRNKQFSQEEVIIVEKLRKKLNQTAMTMVSFYEVEYTFDTNVLSKLLHE
CKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYGPHGNCRPNLKRICEGINKLLDDKIL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 23.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001028707
Locus ID 244882
UniProt ID Q3TBL6
Refseq Size 2225
Cytogenetics 9 A5.3
Refseq ORF 612
Synonyms 9930029P06Rik; Gm517
Summary Acts as a lipid transfer protein. Preferentially captures and shuttles two lipid second messengers, i.e., phosphatidylinositol 4,5- bisphosphate and phosphatidylinositol 3,4,5-trisphosphate and increases their levels in the plasma membrane. Additionally, may also function as a lipid-presenting protein to enhance the activity of the PI3K-AKT and MEK-ERK pathways. May act as a regulator of tumorigenesis through its activation of phospholipid signaling.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...