Nr2c2 (NM_011630) Mouse Recombinant Protein

CAT#: TP521079

Purified recombinant protein of Mouse nuclear receptor subfamily 2, group C, member 2 (Nr2c2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR221079 protein sequence
Red=Cloning site Green=Tags(s)

MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSSKQQFILTSPDGAGTGKVILASPE
TSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKADVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGF
FKRSVRKNLTYSCRSSQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEK
IYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLAADSKAETSQGALGTLANV
VTSLANLSESLNNGDASEMQPEDQSASEITRAFDTLAKALNTTDSASPPSLADGIDASGGGSIHVISRDQ
STPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGY
EYAYLKAIVLFSPDHPGLTGTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEE
LFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 65.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035760
Locus ID 22026
UniProt ID P49117
Refseq Size 7637
Cytogenetics 6 D1
Refseq ORF 1788
Synonyms mKIAA4145; TAK1; Tr4
Summary Orphan nuclear receptor that can act as a repressor or activator of transcription. An important repressor of nuclear receptor signaling pathways such as retinoic acid receptor, retinoid X, vitamin D3 receptor, thyroid hormone receptor and estrogen receptor pathways. May regulate gene expression during the late phase of spermatogenesis. Activates transcriptional activity of LHCG and is antagonist of PPARA-mediated transactivation (By similarity). Together with NR2C1, forms the core of the DRED (direct repeat erythroid-definitive) complex that represses embryonic and fetal globin transcription including that of GATA1. Binds to hormone response elements (HREs) consisting of two 5'-AGGTCA-3' half site direct repeat consensus sequences. Plays a fundamental role in early embryonic development and embryonic stem cells. Required for normal spermatogenesis and cerebellum development. Appears to be important for neurodevelopmentally regulated behavior.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...