Tnnt1 (NM_011618) Mouse Recombinant Protein
CAT#: TP521578
Purified recombinant protein of Mouse troponin T1, skeletal, slow (Tnnt1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR221578 representing NM_011618
Red=Cloning site Green=Tags(s) MSDTEEQEYEEEQAEDEEAVEEEEAPEEPEPVAEREERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRM EKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAK KRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELS EWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 31.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_035748 |
| Locus ID | 21955 |
| UniProt ID | O88346 |
| Refseq Size | 1027 |
| Cytogenetics | 7 2.6 cM |
| Refseq ORF | 783 |
| Synonyms | AW146156; ss; ssTnT; sT; sTnT; Tn; Tnt |
| Summary | This gene encodes the slow skeletal tropomyosin-binding subunit of the troponin complex and plays an essential role in the regulation of striated muscle contraction. In humans, mutations in this gene are associated with nemaline myopathy type 5. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2013] |
Documents
| FAQs |
| SDS |
