S100a14 (NM_001163526) Mouse Recombinant Protein
CAT#: TP521788
Purified recombinant protein of Mouse S100 calcium binding protein A14 (S100a14), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR221788 representing NM_001163526
Red=Cloning site Green=Tags(s) MGQCRSANAESNCGLEEKIANLGNCNDSKLEFGSFWELIGEAAKSVKMERPVTRS myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 6.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001156998 |
| Locus ID | 66166 |
| UniProt ID | Q9D2Q8 |
| Refseq Size | 933 |
| Cytogenetics | 3 F1 |
| Refseq ORF | 165 |
| Synonyms | 1110013O05Rik; S100a15; S114 |
| Summary | Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它S100a14产品
