S100a14 (NM_001163526) Mouse Recombinant Protein
CAT#: TP521788
Purified recombinant protein of Mouse S100 calcium binding protein A14 (S100a14), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR221788 representing NM_001163526
Red=Cloning site Green=Tags(s) MGQCRSANAESNCGLEEKIANLGNCNDSKLEFGSFWELIGEAAKSVKMERPVTRS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 6.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001156998 |
Locus ID | 66166 |
UniProt ID | Q9D2Q8 |
Refseq Size | 933 |
Cytogenetics | 3 F1 |
Refseq ORF | 165 |
Synonyms | 1110013O05Rik; S100a15; S114 |
Summary | Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它S100a14产品