Psmd13 (NM_011875) Mouse Recombinant Protein

CAT#: TP522043

Purified recombinant protein of Mouse proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 (Psmd13), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR222043 representing NM_011875
Red=Cloning site Green=Tags(s)

MKDVPAFLQQSQSSGPGQAAVWHRLEELYTKKLWHQLTLEVLDFVQDPCFAQGDGLIKLYENFISEFEHR
VNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQATKETIEDVEE
MLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGV
FNFGELLMHPVLESLRDTDRQWLIDTLYAFNSGAVDRFQTLKCAWGQQPDLAANEAQLLRKIQLLCLMEM
TFTRPANHRQLTFEEIAKSAKITVNKVELLVMKALSVGLVRGSIDEVDKRVHMTWVQPRVLDLQQIKGMK
DRLELWCTDVKSMEMLVEHQAQDILT

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 42.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_036005
Locus ID 23997
UniProt ID Q9WVJ2, B2RT97
Refseq Size 1563
Cytogenetics 7 F5
Refseq ORF 1128
Synonyms S11
Summary Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...