Dynlrb1 (NM_025947) Mouse Recombinant Protein
CAT#: TP522083
Purified recombinant protein of Mouse dynein light chain roadblock-type 1 (Dynlrb1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR222083 representing NM_025947
Red=Cloning site Green=Tags(s) MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLR IRSKKNEIMVAPDKDYFLIVIQNPTE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 11.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080223 |
Locus ID | 67068 |
UniProt ID | P62627 |
Refseq Size | 702 |
Cytogenetics | 2 H1 |
Refseq ORF | 288 |
Synonyms | 2010012N15Rik; 2010320M17Rik; 9430076K19Rik; AV124457; Dncl2a; DNLC2A; km23-1 |
Summary | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Dynlrb1产品