Dazl (NM_010021) Mouse Recombinant Protein

CAT#: TP522245

Purified recombinant protein of Mouse deleted in azoospermia-like (Dazl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR222245 protein sequence
Red=Cloning site Green=Tags(s)

MSATTSEAPNSAVSREASTQSSSATTSQGYVLPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVK
IITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCTYHVQPRPLIFNPPPPPQFQ
SVWSSPNAETYMQPPTMMNPITQYVQAYPPYPSSPVRVITGYQLPVYNYQMPPQWPAGEQRSYVIPPAYT
TVNYHCSEVDPGADILPNECSVHDAAPASGNGPQKKSVDRSIQTVVSCLFNPENRLRNSLVTQDDYFKDK
RVHHFRRSRAVLKSDHLC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034151
Locus ID 13164
UniProt ID Q64368
Refseq Size 2964
Cytogenetics 17 25.86 cM
Refseq ORF 894
Synonyms Da; Daz-l; Daz-like; Dazh; Dazl1; Dazla; Tpx; Tpx-; Tpx-2; Tpx2
Summary This gene encodes a member of the depleted in azoospermia-like (DAZL) protein family. Members of this family contain an RNA recognition motif, interact with poly A binding proteins, and may be involved in the initiation of translation. The encoded protein is expressed in the cytoplasm of pluripotent stem cells, and in both male and female germ cells, where it is essential for gametogenesis. Disruption of this gene is associated with infertility. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...