Fkbp6 (NM_033571) Mouse Recombinant Protein

CAT#: TP523506

Purified recombinant protein of Mouse FK506 binding protein 6 (Fkbp6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR223506 representing NM_033571
Red=Cloning site Green=Tags(s)

MSVFSRLRNGIPPSRDDCQSPYERLSQRMLDISGDRGVLKDIIREGTGDTVTPDASVLVKYSGYLEHMDK
PFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLFKPAYAYGTLGCPPLIPPNATVLFEIELI
DFLDSAESDKFCALSAEQQEQFPLQKVLKVAATEREFGNYLFRQNRFCDAKVRYKRALLLLHRRLATCEE
QHLVEPAVLLVLLNLSFVYLKLDRPAMALRYGEQALLIDKRNAKALFRCGQACLLLTEYERARDFLVRAQ
KEQPCNHDINNELKKLSSHYRDYVDREREMCHRMFAPCGSRSSVGGN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_291049
Locus ID 94244
UniProt ID Q91XW8
Refseq Size 1447
Cytogenetics 5 75.11 cM
Refseq ORF 981
Synonyms 36kDa; 1700008G22Rik; AU017274; D5Ertd724; D5Ertd724e; FKBP-6; FKBP-36
Summary This gene is a member of the FK506-binding protein (Fkbp) family. The encoded protein plays a role in male-specific fertility and homologous pairing of chromosomes during meiosis. The protein may also be involved in LINE1 transposon silencing and binding to Hsp90 as a co-chaperone. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...