Bhlha15 (NM_010800) Mouse Recombinant Protein
CAT#: TP524224
Purified recombinant protein of Mouse basic helix-loop-helix family, member a15 (Bhlha15), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR224224 representing NM_010800
Red=Cloning site Green=Tags(s) MKTKNRPPRRRTPMQDTEATPGEQTPDRPQSGSGGSELTKGLRSRTARASGGRGEVSRRRQGSGGRRENS VQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLPGLE APGPAPGPKLYQHYHHQQQQQQQQQQVAGAMLGVTEDQPQGHLQRYSTQIHSFREGS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034930 |
Locus ID | 17341 |
UniProt ID | Q9QYC3 |
Refseq Size | 3494 |
Cytogenetics | 5 G2 |
Refseq ORF | 591 |
Synonyms | 1810009C13Rik; Bhlhb8; MIST-1; Mist1 |
Summary | Plays a role in controlling the transcriptional activity of MyoD, ensuring that expanding myoblast populations remain undifferentiated (PubMed:17612490). Repression may occur through muscle-specific E-box occupancy by homodimers. May also negatively regulate bHLH-mediated transcription through an N-terminal repressor domain. Serves as a key regulator of acinar cell function, stability, and identity. Also required for normal organelle localization in exocrine cells and for mitochondrial calcium ion transport. May function as a unique regulator of gene expression in several different embryonic and postnatal cell lineages. Binds to the E-box consensus sequence 5'-CANNTG-3'.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Bhlha15产品