Zadh2 (NM_146090) Mouse Recombinant Protein
CAT#: TP524314
Purified recombinant protein of Mouse zinc binding alcohol dehydrogenase, domain containing 2 (Zadh2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 1 publication. |
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR224314 representing NM_146090
Red=Cloning site Green=Tags(s) MLRLAAAGARAIVDMSYARHFLDFQGSAIPRTMQKLVVTRLSPNFHEAVTLRRDCPVPLPGDGDLLVRNR FVGINASDINYSAGRYDPSLKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIA IPMPSVKPEYLTMLVSGTTAYLSLEELGELSEGKKVLVTAAAGGTGQFAVQLSKIAKCHVIGTCSSDEKA AFLKSIGCDRPINYRTEPVETVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQSPTG LSPIKAGVLPTKLLKKSASLRGFFLNHYFSKYQAAMERLLELYARGDLVCEVDLGHLAPDGRFIGLESVF QAVDYMYTGKNTGKLVVELPHPVSSKL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 41 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_666202 |
| Locus ID | 225791 |
| UniProt ID | Q8BGC4 |
| Refseq Size | 3321 |
| Cytogenetics | 18 E4 |
| Refseq ORF | 1131 |
| Synonyms | C530046K17Rik; PTGR-3; Pthr3 |
| Summary | Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-keto-PGE1, 15-keto-PGE2, 15-keto-PGE1-alpha and 15-keto-PGE2-alpha with highest efficienty towards 15-keto-PGE2-alpha. Overexpression represses transcriptional activity of PPARG and inhibits adipocyte differentiation.[UniProtKB/Swiss-Prot Function] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Prostaglandin reductase-3 negatively modulates adipogenesis through regulation of PPARγ activity [S]
,null,
Journal of Lipid Research
,PubMed ID 23821743
[Zadh2]
|
Documents
| FAQs |
| SDS |
