Eras (NM_181548) Mouse Recombinant Protein
CAT#: TP525172
Purified recombinant protein of Mouse ES cell-expressed Ras (Eras), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR225172 protein sequence
Red=Cloning site Green=Tags(s) MALPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGVGKSALTIQMTHQCFVKDH DPTIQDSYWKEVARDNGGYILNVLDTSGQDIHRALRDQCLASGDGVLGVFALDDPSSLDQLQQIWSTWTP HHKQPLVLVGNKCDLVTTAGDAHAAAALLAHKLGAPLVKTSAKTRQGVEEAFALLVHEIQRAQEAVAESS KKTRHQKAVCSCGCSVA myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 24.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_853526 |
| Locus ID | 353283 |
| UniProt ID | Q7TN89 |
| Refseq Size | 1077 |
| Cytogenetics | X A1.1 |
| Refseq ORF | 681 |
| Synonyms | ecat5; Ha-Ras2; HRAS2; HRasp |
| Summary | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
