Grn (NM_008175) Mouse Recombinant Protein
CAT#: TP525358
Purified recombinant protein of Mouse granulin (Grn), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR225358 representing NM_008175
Red=Cloning site Green=Tags(s) MPPREPGPRRRQTMWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPLLDTWPRITSHHL DGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSCFQMSDNPLGAVQCPG SQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNR AVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTD LLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGI LQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFT CLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQ HCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVC CRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPLL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 65.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_032201 |
| Locus ID | 14824 |
| UniProt ID | P28798 |
| Refseq Size | 2348 |
| Cytogenetics | 11 66.29 cM |
| Refseq ORF | 1806 |
| Synonyms | epithelin; Pgrn |
| Summary | Secreted proteins that act as key regulator of lysosomal function and as a growth factor involved in inflammation, wound healing and cell proliferation (PubMed:28073925, PubMed:8496151, PubMed:28541286, PubMed:28453791, PubMed:20026663, PubMed:23041626, PubMed:27789271, PubMed:12524533). Functions as regulator of proteins trafficking to lysosome and activity of lysosomal enzymes (PubMed:28453791, PubMed:28541286, PubMed:27789271). Facilitates also the acidification of lysosomes, causing degradation of mature CTSD by CTSB (PubMed:28073925). In addition, functions as wound-related growth factor that acts directly on dermal fibroblasts and endothelial cells to promote division, migration and the formation of capillary-like tubule structure (PubMed:12524533). Also promotes epithelial cell proliferation by blocking TNF-mediated neutrophil activation preventing release of oxidants and proteases (PubMed:8496151). Moreover, modulates inflammation in neuron by preserving neuron survival, axonal outgrowth and neuronal integrity (PubMed:23041626, PubMed:20026663).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
