Cd74 (NM_010545) Mouse Recombinant Protein
CAT#: TP525627
Purified recombinant protein of Mouse CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) (Cd74), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR225627 representing NM_010545
Red=Cloning site Green=Tags(s) MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLAGQATTAYFLYQQQGRLDKLTITSQN LQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQL KGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQEL GQVTL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 24.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_034675 |
| Locus ID | 16149 |
| UniProt ID | Q545Y5 |
| Refseq Size | 1239 |
| Cytogenetics | 18 34.41 cM |
| Refseq ORF | 645 |
| Synonyms | CLIP; DHLAG; HLADG; Ia-GAMMA; Ii |
| Summary | Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. Enhance also the stimulation of T-cell responses through interaction with CD44.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
