Rc3h1 (NM_001024952) Mouse Recombinant Protein

CAT#: TP526627

Purified recombinant protein of Mouse RING CCCH (C3H) domains 1 (Rc3h1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR226627 protein sequence
Red=Cloning site Green=Tags(s)

MPVQAPQWTDFLSCPICTQTFDETIRKPISLGCGHTVCKMCLNKLHRKACPFDQTTINTDIELLPVNSAL
LQLVGAQIPEQQPITLCSGVEDTKHYEEAKKCVEELALYLKPLSSARGVGLNSTTQSVLSRPMQRKLVTL
VHCQLVEEEGRIRAMRAARSLGERTVTELILQHQNPQQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLA
LEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALR
REHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTPASFAQSVQELTIALQRTGDPANL
NRLRPHLELLANIDPSPDAPPPTWEQLENGLVAVRTVVHGLVDYIQNHSKKGADQQQPPQHSKYKTYMCR
DMKQRGGCPRGASCTFAHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAPILSDESAVDLSNRKP
PALPNGIASSGSTVTQLIPRGTDPSFDSSLKPVKLDHLSSSAPGSPPDLLESAPKSISALPVNPHPVPPR
GPTDLPPMPVTKPIQMVPRGSQLYPAQQADVYYQDPRGSAPAFETAPYQQGMYYTPPPCVSRFVRPPPSA
PEPGPPYLDHYSPYLQDRVINSQYGTQPQQYPPMYPAHYDGRRVYPAQSYTREEMFRESPIPIDIPSAAV
PSYVPESRERYQQVEGYYPVAPHPAQIRPSYPRDPPYSRLPPPQPHPSLDELHRRRKEIMAQLEERKVIS
PPPFAPSPTLPPAFHPEEFLDEDLKVAGKYKANDYSQYSPWSCDTIGSYIGTKDAKPKDVVAAGSVEMMN
VESKGTREQRLDLQRRAVETSDDDLIPFGDRPTVSRFGAISRTSKTLYQGAGPLQAIAPQGAPTKSINIS
DYSAYGAHGGWGDSPYSPHANIPPQGHFIEREKMSMAEVASHGKPLLSAEREQLRLELQQLNHQISQQTQ
LRGLEAVSNRLVLQREVNTLASQPQPPQLPPKWPGMISSEQLSLELHQVEREIGKRTRELSMENQCSVDM
KSKLGTSKQAENGQPEPQNKIRTEDLTLTFSDVPNGSALTQENLSLLSNKTSSLNLSEDSEGGGDNNDSQ
RSGVVSNSAP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 125.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001020123
Locus ID 381305
UniProt ID Q4VGL6
Refseq Size 11011
Cytogenetics 1 H2.1
Refseq ORF 3390
Synonyms 5730557L09Rik; Gm551; mKIAA2025; N28103
Summary Post-transcriptional repressor of mRNAs containing a conserved stem loop motif, called constitutive decay element (CDE), which is often located in the 3' UTR, as in HMGXB3, ICOS, IER3, NFKBID, NFKBIZ, PPP1R10, TNF, TNFRSF4 and in many more mRNAs (PubMed:23663784, PubMed:25026077, PubMed:18172933). Cleaves translationally inactive mRNAs harboring a stem-loop (SL), often located in their 3' UTRs, during the early phase of inflammation in a helicase UPF1-independent manner (PubMed:26000482). Binds to CDE and promotes mRNA deadenylation and degradation. This process does not involve miRNAs (PubMed:20412057, PubMed:20639877). In follicular helper T (Tfh) cells, represses of ICOS and TNFRSF4/Ox40 expression, thus preventing spontaneous Tfh cell differentiation, germinal center B-cell differentiation in the absence of immunization and autoimmunity. In resting or LPS-stimulated macrophages, controls inflammation by suppressing TNF expression. Also recognizes CDE in its own mRNA and in that of paralogous RC3H2, possibly leading to feedback loop regulation (PubMed:23583642, PubMed:23583643, PubMed:15917799). Inhibits cooperatively with ZC3H12A the differentiation of helper T cells Th17 in lungs. They repress target mRNA encoding the Th17 cell-promoting factors IL6, ICOS, REL, IRF4, NFKBID and NFKBIZ. The cooperation requires RNA-binding by RC3H1 and the nuclease activity of ZC3H12A (PubMed:25282160). Recognizes and binds mRNAs containing a hexaloop stem-loop motif, called alternative decay element (ADE) (PubMed:27010430). Able to interact with double-stranded RNA (By similarity). miRNA-binding protein that regulates microRNA homeostasis. Enhances DICER-mediated processing of pre-MIR146a but reduces mature MIR146a levels through an increase of 3' end uridylation. Both inhibits ICOS mRNA expression and they may act together to exert the suppression (PubMed:25697406). Acts as a ubiquitin E3 ligase. Pairs with E2 enzymes UBE2A, UBE2B, UBE2D2, UBE2F, UBE2G1, UBE2G2 and UBE2L3 and produces polyubiquitin chains. Show the strongest activity when paired with UBE2N:UBE2V1 or UBE2N:UBE2V2 E2 complexes and generate both short and long polyubiquitin chains (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...