Alx3 (NM_007441) Mouse Recombinant Protein

CAT#: TP527095

Purified recombinant protein of Mouse aristaless-like homeobox 3 (Alx3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
ALX3 Antibody - N-terminal region
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR227095 representing NM_007441
Red=Cloning site Green=Tags(s)

MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSRFPACGPLEPYLPEPAKPPAK
YLQDLGPGPVLNGGHFYEGSAEAEEKASKAASFPQLPVDCRGGPRDGPSNVQASPGPCLASLSVPLSPGL
PDSMELAKTKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRK
RERYGKMQEGRNPFTTAYDISVLPRTDSHPQLQNSLWPSPGSGSPGGPCLMSPEGIPSPCMSPYSHSHGN
VAGFMGVPASPAAHPGIYSIHGFPPALGGHSFEPSPDGDYKSPSLVSLRMKPKEPPGLLNWTT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_031467
Locus ID 11694
UniProt ID O70137
Refseq Size 1867
Cytogenetics 3 46.83 cM
Refseq ORF 1029
Summary This gene belongs to Group 1 of aristaless-like genes, which are characterized by the presence of an aristaless domain and a conserved paired-like homeodomain. The encoded protein acts as a transcriptional regulator. The protein plays a role in the development of craniofacial and appendicular skeleton and may have a role in pancreatic function. [provided by RefSeq, Apr 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...