Ptk6 (NM_009184) Mouse Recombinant Protein

CAT#: TP527251

Purified recombinant protein of Mouse PTK6 protein tyrosine kinase 6 (Ptk6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR227251 representing NM_009184
Red=Cloning site Green=Tags(s)

MVSWDKAHLGPKYVGLWDFKARTDEELSFQAGDLLHVTKKEELWWWATLLDAEGKALAEGYVPHNYLAEK
ETVESEPWFFGCISRSEAMHRLQAEDNSKGAFLIRVSQKPGADYVLSVRDAQAVRHYRIWKNNEGRLHLN
EAVSFSNLSELVDYHKTQSLSHGLQLSMPCWKHKTEPLPHWDDWERPREEFTLCKKLGAGYFGEVFEALW
KGQVHVAVKVISRDNLLHQHTFQAEIQAMKKLRHKHILSLYAVATAGDPVYIITELMPKGNLLQLLRDSD
EKALPILELVDFASQVAEGMCYLESQNYIHRDLAARNVLVTENNLCKVGDFGLARLVKEDIYLSHEHNVP
YKWTAPEALSRGHYSIKSDVWSFGVLLHEIFSRGQMPYPGMSNHETFLRVDAGYRMPCPLECPPNIHKLM
LSCWSRDPKQRPCFKDLCEKLTGITRYENLV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 52.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_033210
Locus ID 20459
UniProt ID Q64434
Refseq Size 2286
Cytogenetics 2 103.62 cM
Refseq ORF 1353
Synonyms BRK; Sik; tks; Tksk
Summary Non-receptor tyrosine-protein kinase implicated in the regulation of a variety of signaling pathways that control the differentiation and maintenance of normal epithelia, as well as tumor growth. Function seems to be context dependent and differ depending on cell type, as well as its intracellular localization. A number of potential nuclear and cytoplasmic substrates have been identified. These include the RNA-binding proteins: KHDRBS1/SAM68, KHDRBS2/SLM1, KHDRBS3/SLM2 and SFPQ/PSF; transcription factors: STAT3 and STAT5A/B and a variety of signaling molecules: ARHGAP35/p190RhoGAP, PXN/paxillin, BTK/ATK, STAP2/BKS. Associates also with a variety of proteins that are likely upstream of PTK6 in various signaling pathways, or for which PTK6 may play an adapter-like role. These proteins include ADAM15, EGFR, ERBB2, ERBB3 and IRS4. In normal or non-tumorigenic tissues, PTK6 promotes cellular differentiation and apoptosis. In tumors PTK6 contributes to cancer progression by sensitizing cells to mitogenic signals and enhancing proliferation, anchorage-independent survival and migration/invasion. Association with EGFR, ERBB2, ERBB3 may contribute to mammary tumor development and growth through enhancement of EGF-induced signaling via BTK/AKT and PI3 kinase. Contributes to migration and proliferation by contributing to EGF-mediated phosphorylation of ARHGAP35/p190RhoGAP, which promotes association with RASA1/p120RasGAP, inactivating RhoA while activating RAS. EGF stimulation resulted in phosphorylation of PNX/Paxillin by PTK6 and activation of RAC1 via CRK/CrKII, thereby promoting migration and invasion. PTK6 activates STAT3 and STAT5B to promote proliferation. Nuclear PTK6 may be important for regulating growth in normal epithelia, while cytoplasmic PTK6 might activate oncogenic signaling pathways.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...