Gsk3a (NM_001031667) Mouse Recombinant Protein
CAT#: TP527461
Purified recombinant protein of Mouse glycogen synthase kinase 3 alpha (Gsk3a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
货期*
                        4周
                    规格
                        Product images
                    
                
                         推荐一起购买 (2)
                    
                    
                                        DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
                                    
                                CNY 600.00
Specifications
| Product Data | |
| Species | Mouse | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >MR227461 representing NM_001031667 
Red=Cloning site Green=Tags(s) MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPS GSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATVGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAE TRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFT KAKLITPIIYIKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYI CSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPN YTEFKFPQIKAHPWTKVFKSSKTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRRLGAQLPNDRPL PPLFNFSPGELSIQPSLNAILIPPHLRSPAGPASPLTTSYNPSSQALTEAQTGQDWQPSDATTATLASSS myc-FLAG tag  | 
        
| Tag | C-MYC/DDK | 
| Predicted MW | 52.1 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C after receiving vials. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_001026837 | 
| Locus ID | 606496 | 
| UniProt ID | Q2NL51 | 
| Refseq Size | 2276 | 
| Cytogenetics | 7 A3 | 
| Refseq ORF | 1470 | 
| Synonyms | 2700086H06Rik | 
| Summary | Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1 (PubMed:15791206, PubMed:17908561). Requires primed phosphorylation of the majority of its substrates (PubMed:22539723). Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis (PubMed:15791206, PubMed:17908561). Regulates glycogen metabolism in liver, but not in muscle (PubMed:17908561). May also mediate the development of insulin resistance by regulating activation of transcription factors (By similarity). In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin (PubMed:15791206). Facilitates amyloid precursor protein (APP) processing and the generation of APP-derived amyloid plaques found in Alzheimer disease (By similarity). May be involved in the regulation of replication in pancreatic beta-cells (By similarity). Is necessary for the establishment of neuronal polarity and axon outgrowth (PubMed:17391670). Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation (PubMed:16543145). Acts as a regulator of autophagy by mediating phosphorylation of KAT5/TIP60 under starvation conditions, leading to activate KAT5/TIP60 acetyltransferase activity and promote acetylation of key autophagy regulators, such as ULK1 and RUBCNL/Pacer (PubMed:22539723).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
            You may also need
        
        
    
                         Customer
                                Reviews 
                    
                    
                                Loading...
                            
                        