Adipoq (NM_009605) Mouse Recombinant Protein
CAT#: TP527517
Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Adipoq" proteins (1)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
Product images
                    
                CNY 600.00
Specifications
| Product Data | |
| Species | Mouse | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >MR227517 representing NM_009605 
Red=Cloning site Green=Tags(s) MLLLQALLFLLILPSHAEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGE KGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFY NQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEV GDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN myc-FLAG tag  | 
        
| Tag | C-MYC/DDK | 
| Predicted MW | 27.3 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C after receiving vials. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_033735 | 
| Locus ID | 11450 | 
| UniProt ID | Q60994 | 
| Refseq Size | 1233 | 
| Cytogenetics | 16 13.96 cM | 
| Refseq ORF | 741 | 
| Synonyms | 30kDa; Acdc; Acrp30; Ad; adipo; apM1; APN; GBP28 | 
| Summary | Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| TP721158 | Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq) | 
                                                     CNY 1800.00  | 
                                            
