Recombinant BMP-8a (Bone morphogenetic protein-8a), Human
CAT#: TP728162
Recombinant BMP-8a (Bone morphogenetic protein-8a), Human
|
Need it in bulk or customized? Get a free quote |
CNY 1890.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 16.61 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is 10-19.4 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q7Z5Y6 |
| Synonyms | BMP-8,OP-2,Osteogenic Protein-2 |
| Summary | Bone Morphogenetic Protein-8 (BMP-8) is an extracellular multifunctional cytokine that is also a member of the TGF-β family. BMP-8 can bind with TGF-β receptor and is involved in SMAD protein signal transduction. In addition, BMP-8 participates in the downregulation of insulin secretion that lets the heat stabilize. Moreover, it participates in ossification and is essential to cartilage and hard bone development. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
