Recombinant GDNF (Glial-derived neurotrophic factor), Human

CAT#: TP728220

Recombinant GDNF (Glial-derived neurotrophic factor), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 1890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 16.01 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Purity >95% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce proliferation in SH-SY5Y cells. The ED₅₀ for this effect is <10 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P39905
Synonyms ATF, ATF1, ATF2, HFB1-GDNF, HSCR3
Summary Glial cell line-derived neurotrophic factor (GDNF) is the neurotrophic factor, belonging to the GDNF family of ligands (GFL) and identifying as a therapeutic candidate in Parkinson's disease. GDNF is a 23.7 kDa protein containing 211 residues that plays a critical role in promoting the survival and differentiation of midbrain dopamine neurons. Besides, GDNF is revealed to facilitate the development of peripheral tissues such as kidney, pancreas and lung. Additionally, as a member of GFL, GDNF also takes part in the progression of tumor.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...