Recombinant IL-13 (Interleukin-13), Human
CAT#: TP728240
Recombinant IL-13 (Interleukin-13), Human
|
Need it in bulk or customized? Get a free quote |
CNY 1890.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN with polyhistidine tag at the C-terminus
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 13.28 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >95% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is<0.8 ng/mL. The specific activity of recombinant human IL-13 is approximately >1 x10⁶ IU/ mg. |
| Endotoxin | <0.01 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P35225 |
| Synonyms | NC30 |
| Summary | Interleukin 13 (IL-13) with a molecular mass of 10 kDa cytokine, it secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. It is homologous to IL-4 and shares many of its biologic activities on mononuclear phagocytic cells, endothelial cells, epithelial cells, and B cells. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
