Recombinant IL-28A (Interleukin-28A), Human
CAT#: TP728256M
Recombinant IL-28A (Interleukin-28A), Human
|
Need it in bulk or customized? Get a free quote |
CNY 4880.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 20.60 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <20 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q8IZJ0 |
| Synonyms | IFN-λ2 |
| Summary | Interleukin 28A (IL-28A) predicts a molecular mass of 22.3 kDa. IL-28 comes in two isoforms, IL-28A and IL-28B, and plays a role in immune defense against viruses, including the induction of an antiviral state by turning on Mx proteins, 2',5'-oligoadenylate synthetase as well as ISGF3G. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
