Recombinant IL-36RA (Interleukin-36 receptor antagonist), Human
CAT#: TP728267S
Recombinant IL-36RA (Interleukin-36 receptor antagonist), Human
|
Need it in bulk or customized? Get a free quote |
CNY 700.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD with polyhistidine tag at the C-terminus.
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 17.77 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to inhibit IL-36 gamma-induced IL-8 secretion in PBMC cells. The ED₅₀ for this effect is <2 ng/mL in the presence of 500 ng/mL of recombinant human IL-36 gamma. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q9UBH0 |
| Synonyms | FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra Homolog 1, IL-1 delta |
| Summary | Interleukin 36 receptor antagonist (IL-36RA) is a 16.97 kDa member of IL-1 family with 155 amino acid residues. IL-1RA is expressed by lymphoid tissue, skin and secreted to blood. IL-36Ra functions as a receptor antagonist that inhibits the activation of IL-36R signaling and suppresses pro-inflammatory signaling. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
