Recombinant CXCL10 (C-X-C motif chemokine 10), Mouse
CAT#: TP728306
Recombinant CXCL10 (C-X-C motif chemokine 10), Mouse
|
Need it in bulk or customized? Get a free quote |
CNY 1890.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP with polyhistidine tag at the N-terminus.
|
| Tag | His Tag (N-term) |
| Predicted MW | The protein has a calculated MW of 9.47 kDa. The protein migrates as 7-11 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED₅₀ for this effect is <0.2 μg/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P17515 |
| Synonyms | IP-10, Gamma-Interferon Inducible Protein 10, Crg-2 |
| Summary | C-X-C motif chemokine 10 (CXCL10) also named Interferon gamma-induced protein 10 (IP-10), which is a chemokine of the intercrine alpha family. CXCL10 is a 8.55 kDa protein containing 77 amino acid residues. CXCL10 is produced by the several cell types like monocytes and endothelial cells, which are responsed for IFNγ. CXCL10 is a chemotaxis for T cells, NK cells and macrophages. CXCL10 also binds the CXCR3 that induces the cell migration and activation like T cells and dendritic cells. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
